Welcome Customer !

Membership

Help

Nanjing Xinfan Biotechnology Co., Ltd
Custom manufacturer

Main Products:

smart-city-site>Products

Nanjing Xinfan Biotechnology Co., Ltd

  • E-mail

    3452523816@qq.com

  • Phone

    18013864368

  • Address

    Nanjing Jiangbei New Research and Innovation Park

Contact Now

Recombinant TNFa

NegotiableUpdate on 01/08
Model
Nature of the Manufacturer
Producers
Product Category
Place of Origin

Overview

Recombinant human TNFa: Tumor necrosis factor alpha (TNF - α) is produced by neutrophils, activated lymphocytes, macrophages, NK cells, LAK cells, astrocytes, endothelial cells, smooth muscle cells, and some transformed cells. TNF - α in mice appears in the form of membrane anchoring. The naturally occurring form of TNF - α is glycosylated, but non glycosylated recombinant TNF - α has considerable biological activity. According to reports, the biologically active native form of TNF - α is a trimer. TNF - α in humans and rodents shows approximately 79% homology at the amino acid level, and these two species

Product Details


Product Name:Reorganized personTNFa

Product Code:XFKY1036

Specifications:50ug

Concentration:60ug/ml

Product composition:Reorganized person-TNFa protein solution

Expressing Host:E.coli

Storage conditions:-20frozen

Validity period:1 year

This product is only for scientific research experiments and is not intended for any other purposes.

Background introduction: tumor necrosis factorTNF - α is produced by neutrophils, activated lymphocytes, macrophages, NK cells, LAK cells, astrocytes, endothelial cells, smooth muscle cells, and some transformed cells. TNF - α in mice appears in the form of membrane anchoring. The naturally occurring form of TNF - α is glycosylated, but non glycosylated recombinant TNF - α has considerable biological activity. According to reports, the biologically active native form of TNF - α is a trimer. TNF - α in humans and rodents shows approximately 79% homology at the amino acid level, and there is cross reactivity between these two species.

Product Introduction:

The restructuring personnel produced by our company TNF α is expressed in prokaryotic system, purified, sterilized and filtered, with a molecular weight of approximately 18.6 kDa

Save buffer solution:20mM Tris.Cl,100mM NaClpH8.5

Storage conditions:This product is packaged after sterile filtration and stored in-A 20 ℃ refrigerator should generally avoid repeated freezing and thawing. Suggest dividing into small portions and using one portion each time

Quality inspection:

purityPurity>90% detected by SDS-PAGE electrophoresis

endotoxin: Less than 1EU/Kg

stabilityThe sample is stable after being stored at -20 ℃ for 12 months

Amino acid sequence:

MVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIALLEHHHHHH


Recombinant TNFa

Notes:

1. The product is only for scientific research experiments and should not be used for other purposes such as food, cosmetics, clinical medicine, etc.

2. When using, please wear laboratory clothes, protective masks, disposable laboratory gloves, etc., take good experimental protection, and direct contact is strictly prohibited. Harmful ingestion, strictly prohibited from entering.

3. Please do not dispose of the remaining products at will. Please follow the relevant regulations for the disposal of biochemical waste.

4. Please store it properly according to the storage requirements, and seal and store it in the dark after use.