-
E-mail
3452523816@qq.com
-
Phone
18013864368
-
Address
Nanjing Jiangbei New Research and Innovation Park
Product Categories
Nanjing Xinfan Biotechnology Co., Ltd
Recombinant TNFa
NegotiableUpdate on 02/27
- Model
- Nature of the Manufacturer
- Producers
- Product Category
- Place of Origin
Overview
Recombinant human TNFa: Tumor necrosis factor alpha (TNF - α) is produced by neutrophils, activated lymphocytes, macrophages, NK cells, LAK cells, astrocytes, endothelial cells, smooth muscle cells, and some transformed cells. TNF - α in mice appears in the form of membrane anchoring. The naturally occurring form of TNF - α is glycosylated, but non glycosylated recombinant TNF - α has considerable biological activity. According to reports, the biologically active native form of TNF - α is a trimer. TNF - α in humans and rodents shows approximately 79% homology at the amino acid level, and these two species
Product Details
Product Name:Reorganized personTNFa
Product Code:XFKY1036
Specifications:50ug
Concentration:60ug/ml
Product composition:Reorganized person-TNFa protein solution
Expressing Host:E.coli
Storage conditions:-20℃frozen
Validity period:1 year
This product is only for scientific research experiments and is not intended for any other purposes.
Background introduction: tumor necrosis factorTNF - α is produced by neutrophils, activated lymphocytes, macrophages, NK cells, LAK cells, astrocytes, endothelial cells, smooth muscle cells, and some transformed cells. TNF - α in mice appears in the form of membrane anchoring. The naturally occurring form of TNF - α is glycosylated, but non glycosylated recombinant TNF - α has considerable biological activity. According to reports, the biologically active native form of TNF - α is a trimer. TNF - α in humans and rodents shows approximately 79% homology at the amino acid level, and there is cross reactivity between these two species.
Product Introduction:
The restructuring personnel produced by our company TNF α is expressed in prokaryotic system, purified, sterilized and filtered, with a molecular weight of approximately 18.6 kDa
Save buffer solution:20mM Tris.Cl,100mM NaClpH8.5
Storage conditions:This product is packaged after sterile filtration and stored in-A 20 ℃ refrigerator should generally avoid repeated freezing and thawing. Suggest dividing into small portions and using one portion each time
Quality inspection:
purityPurity>90% detected by SDS-PAGE electrophoresis
endotoxin: Less than 1EU/Kg
stabilityThe sample is stable after being stored at -20 ℃ for 12 months
Amino acid sequence:
MVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIALLEHHHHHH
Recombinant TNFa
Notes:
1. The product is only for scientific research experiments and should not be used for other purposes such as food, cosmetics, clinical medicine, etc.
2. When using, please wear laboratory clothes, protective masks, disposable laboratory gloves, etc., take good experimental protection, and direct contact is strictly prohibited. Harmful ingestion, strictly prohibited from entering.
3. Please do not dispose of the remaining products at will. Please follow the relevant regulations for the disposal of biochemical waste.
4. Please store it properly according to the storage requirements, and seal and store it in the dark after use.
