Welcome Customer !

Membership

Help

Nanjing Xinfan Biotechnology Co., Ltd
Custom manufacturer

Main Products:

smart-city-site>Products

Nanjing Xinfan Biotechnology Co., Ltd

  • E-mail

    3452523816@qq.com

  • Phone

    18013864368

  • Address

    Nanjing Jiangbei New Research and Innovation Park

Contact Now

Recombinant human interleukin-4

NegotiableUpdate on 01/08
Model
Nature of the Manufacturer
Producers
Product Category
Place of Origin

Overview

Recombinant human interleukin-4: The recombinant human interleukin-4 produced by our company is expressed in a prokaryotic system, purified, filtered, and sterilized, with a molecular weight of approximately 16.4 kDa.

Product Details


Product Name:Recombinant human interleukin 4

Product Code:XFKY1024

Specifications:50ug

Concentration:100ug/m

Storage conditions:-20frozen

Validity period:1 year

This product is only for scientific research experiments and is not intended for any other purposes.

Product Introduction:The restructuring of our company's productionPerson IL-4 Made by prokaryotic system expression, separation and purification, filtration and sterilization steps, with a molecular weight of approximately 16.4 kDa.

Product composition:Recombinator IL-4 protein solution

Save buffer solution:50mM Tris.Cl, 1mM EDTA,pH8.5

Storage conditions:This product is stored after sterile filtration-A 20 ℃ refrigerator should generally avoid repeated freezing and thawing. Suggest dividing interleukin-4 protein into small portions and using one portion each time

quality inspection

Purity:sutra SDS-PAGE electrophoresis detected purity>95%

Biological activity:use The dose dependent proliferation assay of TF1 cells resulted in an ED50 of approximately 3.3 ng/ml.

Endotoxins:less than 1 EU/μg

stabilityThe sample is in-Stable storage at 20 ℃ for 12 months

Amino acid sequence:

HKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSSHHHHHH

重组人白介素 4

Notes:

1. The product is only for scientific research experiments and should not be used for other purposes such as food, cosmetics, clinical medicine, etc.

2. When using, please wear laboratory clothes, protective masks, disposable laboratory gloves, etc., take good experimental protection, and direct contact is strictly prohibited. Harmful ingestion, strictly prohibited from entering.

3. Please do not dispose of the remaining products at will. Please follow the relevant regulations for the disposal of biochemical waste.

4. Please store it properly according to the storage requirements, and seal and store it in the dark after use.


Recombinant human interleukin 4