Recombinant human interleukin-1 alpha

NegotiableUpdate on 02/27

Model

Nature of the Manufacturer: Producers

Product Category

Place of Origin

Online Consult

Overview

Recombinant human interleukin-1 alpha: Interleukin-1 alpha (IL-1 alpha), also known as hematopoietic cytokine 1, is a cytokine of the interleukin-1 family encoded by the IL1A gene in humans. Generally speaking, interleukin-1 is responsible for producing inflammation, as well as promoting fever and sepsis. We are currently developing IL-1 α inhibitors to interrupt these processes and treat diseases. IL-1 α is mainly produced by activated macrophages, as well as neutrophils, epithelial cells, and endothelial cells.

Product Details

Product Name:Recombinant human interleukin 1a

Product Code:XFKY1012

Specifications:50ug

Concentration:320ug/ml

Product composition:Recombinant human interleukin1a protein solution

Expressing Host:E.coli

Storage conditions:-20℃frozen

Validity period:1 year

This product is only for scientific research experiments and is not intended for any other purposes.

Background introduction: interleukin 1 α (IL-1 α), also known as hematopoietic cytokine 1, is a cytokine in the interleukin-1 family, encoded by the IL1A gene in humans. Generally speaking, interleukin-1 is responsible for producing inflammation, as well as promoting fever and sepsis. We are currently developing IL-1 α inhibitors to interrupt these processes and treat diseases. IL-1 α is mainly produced by activated macrophages, as well as neutrophils, epithelial cells, and endothelial cells. It has metabolic, physiological, and hematopoietic activities, and plays a central role in regulating immune responses. It binds to the interleukin-1 receptor. It is a pathway that activates tumor necrosis factor alpha.

Product Introduction:

Recombinant human interleukin produced by our company1alpha(IL1alpha）Made by prokaryotic system expression, separation and purification, filtration and sterilization steps, with a molecular weight of approximately 19.6kDa

Save buffer solution:20mM Tris.Cl,pH8.5

Storage conditions:This product is stored after sterile filtration-20℃Refrigerators should generally avoid repeated freezing and thawing. It is recommended to IL1alphaDivide into small portions and use one portion each time.

Quality inspection:

purityPurity>95% as detected by DS-PAGE electrophoresis

endotoxin: Less than 1 EU/μ g

stabilityThe sample remains stable for 12 months at -20 ° C

Amino acid sequence:

MGSAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQASSGLEHHHHHH

重组人白介素 1α

Notes:

1. The product is only for scientific research experiments and should not be used for other purposes such as food, cosmetics, clinical medicine, etc.

2. When using, please wear laboratory clothes, protective masks, disposable laboratory gloves, etc., take good experimental protection, and direct contact is strictly prohibited. Harmful ingestion, strictly prohibited from entering.

3. Please do not dispose of the remaining products at will. Please follow the relevant regulations for the disposal of biochemical waste.

4. Please store it properly according to the storage requirements, and seal and store it in the dark after use.

Recombinant human interleukin1a