Welcome Customer !

Membership

Help

Nanjing Xinfan Biotechnology Co., Ltd
Custom manufacturer

Main Products:

smart-city-site>Products

Nanjing Xinfan Biotechnology Co., Ltd

  • E-mail

    3452523816@qq.com

  • Phone

    18013864368

  • Address

    Nanjing Jiangbei New Research and Innovation Park

Contact Now

Recombinant human interleukin-3

NegotiableUpdate on 01/08
Model
Nature of the Manufacturer
Producers
Product Category
Place of Origin

Overview

Recombinant human interleukin-3: Interleukin-3 (IL-3) is a protein encoded by the IL3 gene located on chromosome 5q31.1. Sometimes referred to as colony-stimulating factor, multicellular factor, mast cell growth factor MULTI-CSF、MCGF; MGC79398, MGC79399: This protein contains 152 amino acids and has a molecular weight of 17 kDa. It is produced in monomeric form by activated T cells, monocytes/macrophages, and stromal cells.

Product Details


Product Name:Recombinant human interleukin 3

Product Code:XFKY1023

Specifications:50ug

Concentration:100ug/ml

Product composition:Recombinant human interleukin3 protein solution

Expressing Host:E.coli

Storage conditions:-20frozen

Validity period:1 year

This product is only for scientific research experiments and is not intended for any other purposes.

Background introduction: interleukinIL-3 is a protein encoded by the IL3 gene located on chromosome 5q31.1. Sometimes referred to as colony-stimulating factor, multicellular factor, mast cell growth factor MULTI-CSF、MCGF; MGC79398, MGC79399: This protein contains 152 amino acids and has a molecular weight of 17 kDa. It is produced in monomeric form by activated T cells, monocytes/macrophages, and stromal cells.

Product Introduction:

Recombinant human interleukin produced by our companyMade from prokaryotic system expression, separation and purification, sterilization and filtration, with a molecular weight of approximately 16.3kDa

Save buffer solution:50mM Tris.CI, pH8.0

Storage conditions:This product is packaged after sterile filtration and stored in-A 20 ° C refrigerator should generally avoid repeated freezing and thawing. Suggest dividing into small portions and using one portion each time.

Quality inspection:

purityPurity>95% as detected by SDS-PAGE electrophoresis

biological activity:useThe dose dependent proliferation assay of TF1 cells resulted in an ED50 of approximately 8.6 ng/ml

endotoxin: Less than 1EU/Kg

stabilityThe sample remains stable for 12 months at -20 ° C

Amino acid sequence:

MAPMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIFLEHHHHHH

重组人白介素 3

Notes:

1. The product is only for scientific research experiments and should not be used for other purposes such as food, cosmetics, clinical medicine, etc.

2. When using, please wear laboratory clothes, protective masks, disposable laboratory gloves, etc., take good experimental protection, and direct contact is strictly prohibited. Harmful ingestion, strictly prohibited from entering.

3. Please do not dispose of the remaining products at will. Please follow the relevant regulations for the disposal of biochemical waste.

4. Please store it properly according to the storage requirements, and seal and store it in the dark after use.


Recombinant human interleukin-3