-
E-mail
3452523816@qq.com
-
Phone
18013864368
-
Address
Nanjing Jiangbei New Research and Innovation Park
Product Categories
Nanjing Xinfan Biotechnology Co., Ltd
Recombinant human interleukin-3
NegotiableUpdate on 02/27
- Model
- Nature of the Manufacturer
- Producers
- Product Category
- Place of Origin
Overview
Recombinant human interleukin-3: Interleukin-3 (IL-3) is a protein encoded by the IL3 gene located on chromosome 5q31.1. Sometimes referred to as colony-stimulating factor, multicellular factor, mast cell growth factor MULTI-CSF、MCGF； MGC79398, MGC79399: This protein contains 152 amino acids and has a molecular weight of 17 kDa. It is produced in monomeric form by activated T cells, monocytes/macrophages, and stromal cells.
Product Details
Product Name:Recombinant human interleukin 3
Product Code:XFKY1023
Specifications:50ug
Concentration:100ug/ml
Product composition:Recombinant human interleukin3 protein solution
Expressing Host:E.coli
Storage conditions:-20℃frozen
Validity period:1 year
This product is only for scientific research experiments and is not intended for any other purposes.
Background introduction: interleukinIL-3 is a protein encoded by the IL3 gene located on chromosome 5q31.1. Sometimes referred to as colony-stimulating factor, multicellular factor, mast cell growth factor MULTI-CSF、MCGF； MGC79398, MGC79399: This protein contains 152 amino acids and has a molecular weight of 17 kDa. It is produced in monomeric form by activated T cells, monocytes/macrophages, and stromal cells.
Product Introduction:
Recombinant human interleukin produced by our companyMade from prokaryotic system expression, separation and purification, sterilization and filtration, with a molecular weight of approximately 16.3kDa
Save buffer solution:50mM Tris.CI, pH8.0
Storage conditions:This product is packaged after sterile filtration and stored in-A 20 ° C refrigerator should generally avoid repeated freezing and thawing. Suggest dividing into small portions and using one portion each time.
Quality inspection:
purityPurity>95% as detected by SDS-PAGE electrophoresis
biological activity:useThe dose dependent proliferation assay of TF1 cells resulted in an ED50 of approximately 8.6 ng/ml
endotoxin: Less than 1EU/Kg
stabilityThe sample remains stable for 12 months at -20 ° C
Amino acid sequence:
MAPMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIFLEHHHHHH
Notes:
1. The product is only for scientific research experiments and should not be used for other purposes such as food, cosmetics, clinical medicine, etc.
2. When using, please wear laboratory clothes, protective masks, disposable laboratory gloves, etc., take good experimental protection, and direct contact is strictly prohibited. Harmful ingestion, strictly prohibited from entering.
3. Please do not dispose of the remaining products at will. Please follow the relevant regulations for the disposal of biochemical waste.
4. Please store it properly according to the storage requirements, and seal and store it in the dark after use.
Recombinant human interleukin-3
